PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA39011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 365aa    MW: 40714.4 Da    PI: 7.938
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA39011genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.91.1e-33111165155
                    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                kprlrWt++LH+rFv+av+qLGG+ kAtPk+i++ m+vkgLtl+h+kSHLQkYRl
  Tp57577_TGAC_v2_mRNA39011 111 KPRLRWTTDLHQRFVDAVTQLGGPSKATPKAIMRSMNVKGLTLYHLKSHLQKYRL 165
                                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.987108168IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-32108166IPR009057Homeodomain-like
SuperFamilySSF466893.76E-16111166IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-24111166IPR006447Myb domain, plants
PfamPF002491.7E-8113164IPR001005SANT/Myb domain
PfamPF143794.9E-13206251IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
LLLGFSSQYQ SLVLFTYPFP YFTSSSSFTK WVISIFFHFS YNSKKISSFS SSWVGGVFCV  60
FVFFSSLKQK MFSRLLRPHD HEGSVAVVQE ETNHHHSHLT DPCLVLTSDP KPRLRWTTDL  120
HQRFVDAVTQ LGGPSKATPK AIMRSMNVKG LTLYHLKSHL QKYRLGKQAG KDSDEGCKDG  180
SYLLESPSTE NSSPKLPVSD ANEGHEVKEA LRAQMEVQSK LHLLVEAEKH LQIRQDAERR  240
YMAMLERACK MLADQFIGDQ TIDTDIQKFQ ELPNTELGGN GMHVSEVPYI LQPQGANCSA  300
ESCLTSLESL RGLTLEGSLG GGTKRMLGLD SMVAPLIWSD TNMRAQGIHL AHQVNPQGIA  360
RYGM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0951071e-141BT095107.1 Soybean clone JCVI-FLGm-19M17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013469265.10.0myb-like transcription factor family protein
TrEMBLA0A072VPG60.0A0A072VPG6_MEDTR; Myb-like transcription factor family protein
STRINGGLYMA10G34050.31e-167(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.12e-64G2-like family protein